PDB entry 2y0o

View 2y0o on RCSB PDB site
Description: the structure of a d-lyxose isomerase from the sigmab regulon of bacillus subtilis
Deposited on 2010-12-07, released 2011-05-25
The last revision was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: 0.147
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable d-lyxose ketol-isomerase
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96578 (Start-166)
      • expression tag (167-171)
  • Heterogens: ZN, SO4, ARS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2y0oA (A:)
    mgitkeevnsyyqkagivltdeevdqiqlmdyglgkerkvglqlfvyvntdrycskelvl
    fpgqtcpehrhppvdgqegkqetfrcrygkvylyvegektplpkvlppqedrehytvwhe
    ielepggqytippntkhwfqageegavvtemsststdkhdiftdprilehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >2y0oA (A:)
    gitkeevnsyyqkagivltdeevdqiqlmdyglgkerkvglqlfvyvntdrycskelvlf
    pgqtcpehrhppvdgqegkqetfrcrygkvylyvegektplpkvlppqedrehytvwhei
    elepggqytippntkhwfqageegavvtemsststdkhdiftdprilehhh