PDB entry 2y0j

View 2y0j on RCSB PDB site
Description: triazoloquinazolines as a novel class of phosphodiesterase 10a (pde10a) inhibitors, part 2, lead-optimisation.
Class: hydrolase
Keywords: hydrolase
Deposited on 2010-12-03, released 2011-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.22412
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase 10a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y0ja_
  • Chain 'B':
    Compound: camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase 10a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2y0jb_
  • Heterogens: AXC, ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y0jA (A:)
    meklsyhsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgts
    cfeleklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliacl
    chdldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeq
    vleiirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtkl
    wpvtkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttl
    tqilpptepllkacrdnlsqwekvirgeetatwrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y0jA (A:)
    wqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsv
    kknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsyl
    qkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdl
    alyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyae
    fwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkac
    rdnlsqwekvirge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y0jB (B:)
    meklsyhsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgts
    cfeleklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliacl
    chdldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeq
    vleiirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtkl
    wpvtkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttl
    tqilpptepllkacrdnlsqwekvirgeetatwrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y0jB (B:)
    wqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsv
    kknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsyl
    qkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdl
    alyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyae
    fwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkac
    rdnlsqwekvirge