PDB entry 2y0a

View 2y0a on RCSB PDB site
Description: structure of dapk1 construct residues 1-304
Class: transferase
Keywords: transferase, calmodulin, esprit
Deposited on 2010-12-01, released 2011-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.20336
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2y0aa_
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y0aA (A:)
    gtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkasavnmekfkkfa
    arkksnngsggglndifeaqkiewhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y0aA (A:)
    vfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredie
    revsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflkq
    ilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtpe
    fvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyfs
    ntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkasavnmekfkkfaar