PDB entry 2xzz

View 2xzz on RCSB PDB site
Description: crystal structure of the human transglutaminase 1 beta-barrel domain
Deposited on 2010-11-30, released 2011-01-26
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-glutamine gamma-glutamyltransferase k
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22735 (7-101)
      • expression tag (5-6)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xzzA (A:)
smyfqsmlsltllgaavvgqecevqivfknplpvtltnvvfrlegsglqrpkilnvgdig
gnetvtlrqsfvpvrpgprqliasldspqlsqvhgviqvdva

    Sequence, based on observed residues (ATOM records):
    >2xzzA (A:)
smlsltllgaavvgqecevqivfknplpvtltnvvfrlegsglqrpkilnvgdiggnetv
tlrqsfvpvrpgprqliasldspqlsqvhgviqvdva