PDB entry 2xzw

View 2xzw on RCSB PDB site
Description: structure of pii from synechococcus elongatus in complex with 2-oxoglutarate at low 2-og concentrations
Class: signaling protein
Keywords: signaling protein
Deposited on 2010-11-29, released 2010-12-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.17785
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • expression tag (112-114)
    Domains in SCOPe 2.05: d2xzwa_
  • Chain 'B':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • expression tag (112-114)
    Domains in SCOPe 2.05: d2xzwb_
  • Chain 'C':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • expression tag (112)
    Domains in SCOPe 2.05: d2xzwc_
  • Chain 'D':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • expression tag (112-114)
    Domains in SCOPe 2.05: d2xzwd_
  • Chain 'E':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2xzwe_
  • Chain 'F':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • expression tag (112)
    Domains in SCOPe 2.05: d2xzwf_
  • Chain 'G':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • expression tag (112-114)
    Domains in SCOPe 2.05: d2xzwg_
  • Chain 'H':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2xzwh_
  • Chain 'I':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2xzwi_
  • Heterogens: ATP, AKG, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xzwA (A:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xzwA (A:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteytveflqklkleivve
    daqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xzwB (B:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xzwB (B:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqtereytveflqklkleiv
    vedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xzwC (C:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xzwC (C:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadais
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xzwD (D:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xzwD (D:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgtveflqklkleivvedaqv
    dtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2xzwE (E:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xzwE (E:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrveflqklkleivvedaqvdtvi
    dkivaaartgeigdgkifvspvdqtirirtgeknada
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2xzwF (F:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xzwF (F:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqterytveflqklkleivv
    edaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadais
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2xzwG (G:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xzwG (G:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteeytveflqklkleivv
    edaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2xzwH (H:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xzwH (H:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgekna
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2xzwI (I:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xzwI (I:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryveflqklkleivve
    daqvdtvidkivaaartgeigdgkifvspvdqtirirtgekna