PDB entry 2xzs

View 2xzs on RCSB PDB site
Description: Death associated protein kinase 1 residues 1-312
Class: transferase
Keywords: transferase, calmodulin, esprit
Deposited on 2010-11-29, released 2011-12-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18464
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: death associated kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2xzsa_
  • Chain 'B':
    Compound: death associated kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2xzsb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xzsA (A:)
    gtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkasavnmekfkkfa
    arkkwkqsvrli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xzsA (A:)
    frqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrssrrgvsredierevs
    ilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflkqilng
    vyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtpefvap
    eivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyfsntsa
    lakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkasavnmekfkkfaarsvrl
    i
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xzsB (B:)
    gtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkasavnmekfkkfa
    arkkwkqsvrli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xzsB (B:)
    frqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrgvsredierevsilk
    eiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflkqilngvyy
    lhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtpefvapeiv
    nyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyfsntsalak
    dfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkasavnmekfkkfaar