PDB entry 2xyu

View 2xyu on RCSB PDB site
Description: Crystal structure of EphA4 kinase domain in complex with VUF 12058
Class: transferase
Keywords: signaling protein, transferase
Deposited on 2010-11-19, released 2011-11-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.1916
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ephrin type-a receptor 4,
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2xyua_
  • Heterogens: GOL, Q9G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xyuA (A:)
    fakeidascikiekvigvgefgevcsgrlkvpgkreicvaiktlkagytdkqrrdflsea
    simgqfdhpniihlegvvtkckpvmiiteymengsldaflrkndgrftviqlvgmlrgig
    sgmkylsdmsyvhrdlaarnilvnsnlvckvsdfgmsrvleddpeaayttrggkipirwt
    apeaiayrkftsasdvwsygivmwevmsygerpywdmsnqdvikaieegyrlpppmdcpi
    alhqlmldcwqkersdrpkfgqivnmldklirnpnslkrtgsess
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xyuA (A:)
    fakeidascikiekvigvgefgevcsgrlkvpgkreicvaiktlkagytdkqrrdflsea
    simgqfdhpniihlegvvtkckpvmiiteymengsldaflrkndgrftviqlvgmlrgig
    sgmkylsdmsyvhrdlaarnilvnsnlvckvsdfipirwtapeaiayrkftsasdvwsyg
    ivmwevmsygerpywdmsnqdvikaieegyrlpppmdcpialhqlmldcwqkersdrpkf
    gqivnmldklirnpnslkrt