PDB entry 2xyn

View 2xyn on RCSB PDB site
Description: human abl2 in complex with aurora kinase inhibitor vx-680
Class: transferase
Keywords: cell adhesion, structural genomics consortium, sgc, transferase
Deposited on 2010-11-18, released 2010-12-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.24782
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ABL2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2xyna_
  • Chain 'B':
    Compound: Tyrosine-protein kinase ABL2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2xynb_
  • Chain 'C':
    Compound: Tyrosine-protein kinase ABL2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2xync_
  • Heterogens: NA, VX6, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xynA (A:)
    mghhhhhhssgvdlgtenlyfqsmdkwemertditmkhklgggqygevyvgvwkkysltv
    avktlkedtmeveeflkeaavmkeikhpnlvqllgvctleppfyivteympygnlldylr
    ecnreevtavvllymatqissameylekknfihrdlaarnclvgenhvvkvadfglsrlm
    tgdtytahagakfpikwtapeslayntfsiksdvwafgvllweiatygmspypgidlsqv
    ydllekgyrmeqpegcppkvyelmracwkwspadrpsfaethqafetmfhds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xynA (A:)
    kwemertditmkhklgggqygevyvgvwkkysltvavktldtmeveeflkeaavmkeikh
    pnlvqllgvctleppfyivteympygnlldylrecnreevtavvllymatqissameyle
    kknfihrdlaarnclvgenhvvkvadfglsrlmtgdtytahagakfpikwtapeslaynt
    fsiksdvwafgvllweiatygmspypgidlsqvydllekgyrmeqpegcppkvyelmrac
    wkwspadrpsfaethqafetmfhd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xynB (B:)
    mghhhhhhssgvdlgtenlyfqsmdkwemertditmkhklgggqygevyvgvwkkysltv
    avktlkedtmeveeflkeaavmkeikhpnlvqllgvctleppfyivteympygnlldylr
    ecnreevtavvllymatqissameylekknfihrdlaarnclvgenhvvkvadfglsrlm
    tgdtytahagakfpikwtapeslayntfsiksdvwafgvllweiatygmspypgidlsqv
    ydllekgyrmeqpegcppkvyelmracwkwspadrpsfaethqafetmfhds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xynB (B:)
    kwemertditmkhklgggqygevyvgvwkkysltvavktldtmeveeflkeaavmkeikh
    pnlvqllgvctleppfyivteympygnlldylrecnreevtavvllymatqissameyle
    kknfihrdlaarnclvgenhvvkvadfglsrlmtgdtytahagakfpikwtapeslaynt
    fsiksdvwafgvllweiatygmspypgidlsqvydllekgyrmeqpegcppkvyelmrac
    wkwspadrpsfaethqafetmfhd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xynC (C:)
    mghhhhhhssgvdlgtenlyfqsmdkwemertditmkhklgggqygevyvgvwkkysltv
    avktlkedtmeveeflkeaavmkeikhpnlvqllgvctleppfyivteympygnlldylr
    ecnreevtavvllymatqissameylekknfihrdlaarnclvgenhvvkvadfglsrlm
    tgdtytahagakfpikwtapeslayntfsiksdvwafgvllweiatygmspypgidlsqv
    ydllekgyrmeqpegcppkvyelmracwkwspadrpsfaethqafetmfhds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xynC (C:)
    wemertditmkhklgggqygevyvgvwkkysltvavktlktmeveeflkeaavmkeikhp
    nlvqllgvctleppfyivteympygnlldylrecnreevtavvllymatqissameylek
    knfihrdlaarnclvgenhvvkvadfglsrlmtgdtytahagakfpikwtapeslayntf
    siksdvwafgvllweiatygmspypgidlsqvydllekgyrmeqpegcppkvyelmracw
    kwspadrpsfaethqafetmfh