PDB entry 2xyl

View 2xyl on RCSB PDB site
Description: cellulomonas fimi xylanase/cellulase complexed with 2-deoxy-2-fluoro-xylobiose
Class: hydrolase
Keywords: hydrolase, o-glycosyl, xylanase/cellulase, a/b barrel, cellulose degradation
Deposited on 1997-11-20, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-1,4-glycanase
    Species: CELLULOMONAS FIMI [TaxId:1708]
    Database cross-references and differences (RAF-indexed):
    • GB AAA56792 (0-311)
    Domains in SCOPe 2.07: d2xyla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xylA (A:)
    attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
    gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
    swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
    nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
    psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
    kkpayaavmeaf