PDB entry 2xyk

View 2xyk on RCSB PDB site
Description: Group II 2-on-2 Hemoglobin from the Plant Pathogen Agrobacterium tumefaciens
Class: oxygen storage/transport
Keywords: oxygen storage-transport complex, 2/2 hemoglobin
Deposited on 2010-11-18, released 2010-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18323
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-on-2 hemoglobin
    Species: Agrobacterium tumefaciens [TaxId:358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xyka_
  • Chain 'B':
    Compound: 2-on-2 hemoglobin
    Species: Agrobacterium tumefaciens [TaxId:358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xykb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xykA (A:)
    mssetvtlyeaiggdatvraltrrfyelmdtlpeaarcraihpadlsgseakfydyltgy
    lggppvyvekhghpmlrrrhfvapigpaerdewllcfrramdetienaklreiiwapver
    lafhmqnqeadnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xykA (A:)
    mssetvtlyeaiggdatvraltrrfyelmdtlpeaarcraihpadlsgseakfydyltgy
    lggppvyvekhghpmlrrrhfvapigpaerdewllcfrramdetienaklreiiwapver
    lafhmqnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xykB (B:)
    mssetvtlyeaiggdatvraltrrfyelmdtlpeaarcraihpadlsgseakfydyltgy
    lggppvyvekhghpmlrrrhfvapigpaerdewllcfrramdetienaklreiiwapver
    lafhmqnqeadnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xykB (B:)
    mssetvtlyeaiggdatvraltrrfyelmdtlpeaarcraihpadlsgseakfydyltgy
    lggppvyvekhghpmlrrrhfvapigpaerdewllcfrramdetienaklreiiwapver
    lafhmqnqea