PDB entry 2xyh

View 2xyh on RCSB PDB site
Description: caspase-3:cas60254719
Deposited on 2010-11-17, released 2011-08-17
The last revision was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.1773
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: caspase-3 subunit p17
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: caspase-3 subunit p12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TQ9, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xyhA (A:)
sgisldnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnk
ndltreeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrc
rsltgkpklfiiqacrgteldcgiet

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2xyhB (B:)
hkipveadflyaystapgyyswrnskdgswfiqslcamlkqyadklefmhiltrvnrkva
tefesfsfdatfhakkqipcivsmltkelyfyh