PDB entry 2xyg

View 2xyg on RCSB PDB site
Description: caspase-3:cas329306
Deposited on 2010-11-17, released 2011-08-17
The last revision was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.1794
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: caspase-3 subunit p17
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: caspase-3 subunit p12
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TQ8, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xygA (A:)
sgisldnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnk
ndltreeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrc
rsltgkpklfiiqacrgteldcgiet

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2xygB (B:)
hkipveadflyaystapgyyswrnskdgswfiqslcamlkqyadklefmhiltrvnrkva
tefesfsfdatfhakkqipcivsmltkelyfyh