PDB entry 2xyc

View 2xyc on RCSB PDB site
Description: crystal structure of ncam2 igiv-fn3i
Deposited on 2010-11-17, released 2011-02-23
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neural cell adhesion molecule 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, EPE, PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xycA (A:)
qphiiqlknettyengqvtlvcdaegepipeitwkravdgftftegdksldgrievkgqh
gssslhikdvklsdsgrydceaasrigghqksmyldieyapkfisnqtiyyswegnpini
scdvksnppasihwrrdklvlpaknttnlktystgrkmileiaptsdndfgrynctatnh
igtrfqeyilaladvpsspygvkiielsqttakvsfnkpdshggvpihhyqvdvkevase
iwkivrshgvqtmvvlnnlepnttyeirvaavngkgqgdyskieifqtlpv