PDB entry 2xya

View 2xya on RCSB PDB site
Description: non-covalent inhibtors of rhinovirus 3c protease.
Class: hydrolase
Keywords: hydrolase, cysteine protease
Deposited on 2010-11-16, released 2011-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22987
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: picornain 3c
    Species: HUMAN RHINOVIRUS SP. [TaxId:169066]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04936 (2-181)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2xyaa1, d2xyaa2
  • Heterogens: 7L4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xyaA (A:)
gsgpeeefgmslikhnscvittengkftglgvydrfvvvpthadpgkeiqvdgittkvid
sydlynkngikleitvlkldrnekfrdirryipnneddypncnlallanqpeptiinvgd
vvsygnillsgnqtarmlkysyptksgycggvlykigqvlgihvggngrdgfsamllrsy
ft