PDB entry 2xy8

View 2xy8 on RCSB PDB site
Description: paramagnetic-based nmr structure of the complex between the n-terminal epsilon domain and the theta domain of the DNA polymerase III
Class: transferase
Keywords: transferase, docking, experimental restraints, haddock program
Deposited on 2010-11-16, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase III subunit epsilon
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xy8a_
  • Chain 'B':
    Compound: DNA polymerase III subunit theta
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xy8b_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xy8A (A:)
    mstaitrqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdp
    eafgvhgiadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipk
    tntfckvtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg
    gqtsma
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xy8A (A:)
    rqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgvh
    giadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfck
    vtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xy8B (B:)
    mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
    lasvnlsrlpyepklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xy8B (B:)
    qtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahrlasvnlsrl
    p