PDB entry 2xy2

View 2xy2 on RCSB PDB site
Description: crystal structure of ncam2 ig1-2
Class: cell adhesion
Keywords: cell adhesion
Deposited on 2010-11-12, released 2011-02-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neural cell adhesion molecule 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2xy2a1, d2xy2a2
  • Heterogens: NAG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xy2A (A:)
    allqvtislskvelsvgeskfftctaigepesidwynpqgekiistqrvvvqkegvrsrl
    tiynaniedagiyrcqatdakgqtqeatvvleiyqkltfrevvspqefkqgedaevvcrv
    ssspapavswlyhneevttisdnrfamlannnlqilninksdegiyrcegrveargeidf
    rdiivivnv