PDB entry 2xxx

View 2xxx on RCSB PDB site
Description: Crystal structure of the GluK2 (GluR6) D776K LBD dimer in complex with glutamate (P21 21 21)
Class: transport protein
Keywords: transport protein
Deposited on 2010-11-12, released 2011-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.1812
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor, ionotropic kainate 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42260 (119-End)
      • linker (117-118)
      • engineered mutation (228)
    Domains in SCOPe 2.07: d2xxxa_
  • Chain 'B':
    Compound: Glutamate receptor, ionotropic kainate 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42260 (119-End)
      • linker (117-118)
      • engineered mutation (228)
    Domains in SCOPe 2.07: d2xxxb_
  • Chain 'C':
    Compound: Glutamate receptor, ionotropic kainate 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42260 (119-End)
      • linker (117-118)
      • engineered mutation (228)
    Domains in SCOPe 2.07: d2xxxc_
  • Chain 'D':
    Compound: Glutamate receptor, ionotropic kainate 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42260 (119-End)
      • linker (117-118)
      • engineered mutation (228)
    Domains in SCOPe 2.07: d2xxxd_
  • Heterogens: GLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xxxA (A:)
    gsnrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgk
    ygaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtp
    idsaddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqr
    vltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrkkitiailqlqe
    egklhmmkekwwrgngcpepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xxxA (A:)
    slivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkygaq
    ddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpidsa
    ddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvlts
    dyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrkkitiailqlqeegkl
    hmmkekww
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xxxB (B:)
    gsnrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgk
    ygaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtp
    idsaddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqr
    vltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrkkitiailqlqe
    egklhmmkekwwrgngcpepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xxxB (B:)
    slivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkygaq
    ddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpidsa
    ddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvlts
    dyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrkkitiailqlqeegkl
    hmmkekww
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xxxC (C:)
    gsnrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgk
    ygaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtp
    idsaddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqr
    vltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrkkitiailqlqe
    egklhmmkekwwrgngcpepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xxxC (C:)
    slivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkygaq
    ddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpidsa
    ddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvlts
    dyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrkkitiailqlqeegkl
    hmmkekww
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xxxD (D:)
    gsnrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgk
    ygaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtp
    idsaddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqr
    vltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrkkitiailqlqe
    egklhmmkekwwrgngcpepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xxxD (D:)
    rslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkyga
    qdgqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpidsadd
    lakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvltsdy
    aflmesttiefvtqrncnltqigglidskgygvgtpmgspyrkkitiailqlqeegklhm
    mkekww