PDB entry 2xxr

View 2xxr on RCSB PDB site
Description: Crystal structure of the GluK2 (GluR6) wild-type LBD dimer in complex with glutamate
Class: transport protein
Keywords: transport protein
Deposited on 2010-11-11, released 2011-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.1706
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor, ionotropic kainate 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42260 (119-End)
      • linker (117-118)
    Domains in SCOPe 2.07: d2xxra_
  • Chain 'B':
    Compound: Glutamate receptor, ionotropic kainate 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42260 (119-End)
      • linker (117-118)
    Domains in SCOPe 2.07: d2xxrb_
  • Heterogens: GLU, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xxrA (A:)
    gsnrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgk
    ygaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtp
    idsaddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqr
    vltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqe
    egklhmmkekwwrgngcpepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xxrA (A:)
    slivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkygaq
    ddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpidsa
    ddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvlts
    dyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqeegkl
    hmmkekww
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xxrB (B:)
    gsnrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgk
    ygaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtp
    idsaddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqr
    vltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqe
    egklhmmkekwwrgngcpepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xxrB (B:)
    slivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkygaq
    ddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpidsa
    ddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvlts
    dyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailqlqeegkl
    hmmkekwwr