PDB entry 2xxn

View 2xxn on RCSB PDB site
Description: structure of the virf4-hausp traf domain complex
Deposited on 2010-11-11, released 2011-11-09
The last revision was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.15861
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: k10
    Species: HUMAN HERPESVIRUS 8 [TaxId:37296]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xxnA (A:)
tswrseatfqftverfsrlsesvlsppcfvrnlpwkimvmprfypdrphqksvgfflqcn
aesdstswschaqavlkiinyrddeksfsrrishlffhkendwgfsnfmawsevtdpekg
fidddkvtfevfvqadaphgvaw

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2xxnB (B:)
svwipvnegastsgm