PDB entry 2xxm

View 2xxm on RCSB PDB site
Description: crystal structure of the hiv-1 capsid protein c-terminal domain in complex with a camelid vhh and the cai peptide.
Class: immune system/peptide
Keywords: immune system-peptide complex, capsid inhibitor, protein binding, protein interface, virus assembly
Deposited on 2010-11-10, released 2011-10-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.1935
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein p24
    Species: HUMAN IMMUNODEFICIENCY VIRUS [TaxId:12721]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: camelid vhh 9
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XXM
    Domains in SCOPe 2.05: d2xxmb_
  • Chain 'T':
    Compound: inhibitor of capsid assembly
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XXM (0-10)
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xxmB (B:)
    maqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmst
    vyddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvsshhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xxmB (B:)
    lvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstvydds
    vkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvss
    

  • Chain 'T':
    No sequence available.