PDB entry 2xxe

View 2xxe on RCSB PDB site
Description: single point mutant of Thermus thermophilus lactate dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase, thermophile
Deposited on 2010-11-10, released 2010-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.1871
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (198)
    Domains in SCOPe 2.06: d2xxea1, d2xxea2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (198)
    Domains in SCOPe 2.06: d2xxeb1, d2xxeb2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (198)
    Domains in SCOPe 2.06: d2xxec1, d2xxec2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJA1 (0-309)
      • engineered mutation (198)
    Domains in SCOPe 2.06: d2xxed1, d2xxed2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xxeA (A:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargaalspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xxeB (B:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargaalspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xxeB (B:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlldrnaqvfaqvvprvleaapeavllvatnpvdvm
    tqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvwss
    aqvggvpllefaeargaalspedraridegvrraayriiegkgatyygigaglarlvrai
    ltdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaeilk
    eaafalgf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xxeC (C:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargaalspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xxeC (C:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqetrlqlldrnaqvfaqvvprvleaapeavllvatnpvdvmt
    qvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvwssa
    qvggvpllefaeargaalspedraridegvrraayriiegkgatyygigaglarlvrail
    tdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaeilke
    aafalgf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xxeD (D:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
    vmtqvayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvw
    ssaqvggvpllefaeargaalspedraridegvrraayriiegkgatyygigaglarlvr
    ailtdekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaei
    lkeaafalgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xxeD (D:)
    mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
    sygdlegaravvlaagvetrlqlldrnaqvfaqvvprvleaapeavllvatnpvdvmtqv
    ayrlsglppgrvvgsgtildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqv
    ggvpllefaeargaalspedraridegvrraayriiegkgatyygigaglarlvrailtd
    ekgvytvsaftpevegvlevslslprilgaggvegtvypslspeerealrrsaeilkeaa
    falgf