PDB entry 2xxc

View 2xxc on RCSB PDB site
Description: crystal structure of a camelid vhh raised against the hiv-1 capsid protein c-terminal domain.
Class: immune system
Keywords: immune system
Deposited on 2010-11-10, released 2011-10-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.1815
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: camelid vhh 9
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XXC
    Domains in SCOPe 2.02: d2xxcb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xxcB (B:)
    maqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmst
    vyddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvsshhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xxcB (B:)
    aqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstv
    yddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvss