PDB entry 2xxc

View 2xxc on RCSB PDB site
Description: Crystal structure of a camelid VHH raised against the HIV-1 capsid protein C-terminal domain.
Class: immune system
Keywords: immune system
Deposited on 2010-11-10, released 2011-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: camelid vhh 9
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XXC
    Domains in SCOPe 2.08: d2xxcb1, d2xxcb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2xxcB (B:)
maqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmst
vyddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvsshhhhh
h

    Sequence, based on observed residues (ATOM records): (download) 
    >2xxcB (B:)
aqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstv
yddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvss