PDB entry 2xx6

View 2xx6 on RCSB PDB site
Description: structure of the bacillus subtilis prophage dutpase, yoss
Class: hydrolase
Keywords: hydrolase
Deposited on 2010-11-08, released 2011-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.17372
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spbc2 prophage-derived deoxyuridine 5'-triphosphate nucleotidohydrolase yoss
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xx6a_
  • Chain 'B':
    Compound: spbc2 prophage-derived deoxyuridine 5'-triphosphate nucleotidohydrolase yoss
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xx6b_
  • Chain 'C':
    Compound: spbc2 prophage-derived deoxyuridine 5'-triphosphate nucleotidohydrolase yoss
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xx6c_
  • Chain 'D':
    Compound: spbc2 prophage-derived deoxyuridine 5'-triphosphate nucleotidohydrolase yoss
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xx6d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xx6A (A:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrlgngdrgghgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xx6A (A:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xx6B (B:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrlgngdrgghgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xx6B (B:)
    mqikikyldetqtringdwidlraaedvaikkdefklvplgvamelpegyeahvvprsst
    yknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpavdlie
    vdrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xx6C (C:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrlgngdrgghgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xx6C (C:)
    mqikikyldetqtrimeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvprs
    styknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpavdl
    ievdrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xx6D (D:)
    mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav
    dlievdrlgngdrgghgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xx6D (D:)
    mqikikyldetqtrigdwidlraaedvaikkdefklvplgvamelpegyeahvvprssty
    knfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpavdliev
    drl