PDB entry 2xwq

View 2xwq on RCSB PDB site
Description: anaerobic cobalt chelatase from archeaoglobus fulgidus (cbix) in complex with metalated sirohydrochlorin product
Class: lyase
Keywords: lyase, beta-alpha-beta, cobalamin biosynthesis, metal-binding, parallel beta sheet
Deposited on 2010-11-04, released 2010-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.21979
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sirohydrochlorin cobaltochelatase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29537 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d2xwqa1, d2xwqa2
  • Chain 'B':
    Compound: sirohydrochlorin cobaltochelatase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xwqb_
  • Chain 'C':
    Compound: sirohydrochlorin cobaltochelatase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29537 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d2xwqc1, d2xwqc2
  • Chain 'D':
    Compound: sirohydrochlorin cobaltochelatase
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xwqd_
  • Heterogens: SIR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xwqA (A:)
    gmrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemnc
    diiyvvplfisyglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailn
    svfrigrdgkgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xwqA (A:)
    gmrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemnc
    diiyvvplfisyglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailn
    svfrig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xwqB (B:)
    gmrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemnc
    diiyvvplfisyglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailn
    svfrigrdgkgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xwqB (B:)
    mrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemncd
    iiyvvplfisyglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailns
    vfrig
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xwqC (C:)
    gmrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemnc
    diiyvvplfisyglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailn
    svfrigrdgkgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xwqC (C:)
    gmrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemnc
    diiyvvplfisyglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailn
    svfrig
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xwqD (D:)
    gmrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemnc
    diiyvvplfisyglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailn
    svfrigrdgkgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xwqD (D:)
    mrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemncd
    iiyvvplfisyglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailns
    vfrig