PDB entry 2xwm

View 2xwm on RCSB PDB site
Description: Crystal structure of IspD from Mycobacterium smegmatis in complex with CMP
Class: transferase
Keywords: transferase, mep pathway
Deposited on 2010-11-04, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18185
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0R560 (Start-218)
      • expression tag (219-220)
    Domains in SCOPe 2.07: d2xwma1, d2xwma2
  • Chain 'B':
    Compound: 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0R560 (Start-218)
      • expression tag (219-222)
    Domains in SCOPe 2.07: d2xwmb1, d2xwmb2
  • Heterogens: C5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xwmA (A:)
    matvavvpaagsgerlragrpkafvtlggtpllehalsglrasgvidriviavppaltde
    sklvfggedsvivsggvdrtesvalaleaagdaefvlvhdaaraltppaliarvvaalke
    ghsavvpglapadtikavdangavlgtperaglravqtpqgfhadvlrrayarataggvt
    ddaslveqlgtpvqivdgdplafkittpldlvlaeavlahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xwmA (A:)
    atvavvpaagsgerlragrpkafvtlggtpllehalsglrasgvidriviavppaltdes
    klvfggedsvivsggvdrtesvalaleaagdaefvlvhdaaraltppaliarvvaalkeg
    hsavvpglapadtikavdangavlgtperaglravqtpqgfhadvlrrayarataggvtd
    daslveqlgtpvqivdgdplafkittpldlvlaeavlahh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xwmB (B:)
    matvavvpaagsgerlragrpkafvtlggtpllehalsglrasgvidriviavppaltde
    sklvfggedsvivsggvdrtesvalaleaagdaefvlvhdaaraltppaliarvvaalke
    ghsavvpglapadtikavdangavlgtperaglravqtpqgfhadvlrrayarataggvt
    ddaslveqlgtpvqivdgdplafkittpldlvlaeavlahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xwmB (B:)
    atvavvpaagsgerlragrpkafvtlggtpllehalsglrasgvidriviavppaltdes
    klvfggedsvivsggvdrtesvalaleaagdaefvlvhdaaraltppaliarvvaalkeg
    hsavvpglapadtikavdangavlgtperaglravqtpqgfhadvlrrayarataggvtd
    daslveqlgtpvqivdgdplafkittpldlvlaeavlahhhh