SCOPe 2.08: Structural Classification of Proteins

PDB entry 2xwj

View 2xwj on RCSB PDB site
Description: crystal structure of complement c3b in complex with factor b
Deposited on 2010-11-04, released 2011-01-12
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 4 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Complement C3 beta chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P01024 (0-End)
Chain 'B':
Compound: Complement C3 alpha chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P01024 (Start-914)
  - engineered mutation (264)
Chain 'C':
Compound: Complement C3 beta chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P01024 (0-End)
Chain 'D':
Compound: Complement C3 alpha chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P01024 (Start-914)
  - engineered mutation (264)
Chain 'E':
Compound: Complement C3 beta chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P01024 (0-End)
Chain 'F':
Compound: Complement C3 alpha chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P01024 (Start-914)
  - engineered mutation (264)
Chain 'G':
Compound: Complement C3 beta chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P01024 (0-End)
Chain 'H':
Compound: Complement C3 alpha chain
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P01024 (Start-914)
  - engineered mutation (264)
Chain 'I':
Compound: complement factor b
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P00751 (Start-738)
  - expression tag (739-740)
  - engineered mutation (253)
  - engineered mutation (259)
Chain 'J':
Compound: complement factor b
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P00751 (Start-738)
  - expression tag (739-740)
  - engineered mutation (253)
  - engineered mutation (259)
Chain 'K':
Compound: complement factor b
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P00751 (Start-738)
  - expression tag (739-740)
  - engineered mutation (253)
  - engineered mutation (259)
Chain 'L':
Compound: complement factor b
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P00751 (Start-738)
  - expression tag (739-740)
  - engineered mutation (253)
  - engineered mutation (259)
Heterogens: NAG, NI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

Chain 'A':
Sequence, based on SEQRES records:

>2xwjA (A:)
spmysiitpnilrleseetmvleahdaqgdvpvtvtvhdfpgkklvlssektvltpatnh
mgnvtftipanrefksekgrnkfvtvqatfgtqvvekvvlvslqsgylfiqtdktiytpg
stvlyriftvnhkllpvgrtvmvnienpegipvkqdslssqnqlgvlplswdipelvnmg
qwkirayyenspqqvfstefevkeyvlpsfeviveptekfyyiynekglevtitarflyg
kkvegtafvifgiqdgeqrislpeslkripiedgsgevvlsrkvlldgvqnpraedlvgk
slyvsatvilhsgsdmvqaersgipivtspyqihftktpkyfkpgmpfdlmvfvtnpdgs
payrvpvavqgedtvqsltqgdgvaklsinthpsqkplsitvrtkkqelseaeqatrtmq
alpystvgnsnnylhlsvlrtelrpgetlnvnfllrmdraheakiryytylimnkgrllk
agrqvrepgqdlvvlplsittdfipsfrlvayytligasgqrevvadsvwvdvkdscvgs
lvvksgqsedrqpvpgqqmtlkiegdhgarvvlvavdkgvfvlnkknkltqskiwdvvek
adigctpgsgkdyagvfsdagltftsssgqqtaqraelqcpqpaa