PDB entry 2xw9

View 2xw9 on RCSB PDB site
Description: crystal structure of complement factor d mutant s183a
Class: hydrolase
Keywords: immune system, hydrolase, serine protease, alternative pathway
Deposited on 2010-11-01, released 2011-01-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.14528
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00746 (0-227)
      • engineered mutation (182)
    Domains in SCOPe 2.01: d2xw9a_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xw9A (A:)
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdaggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla