PDB entry 2xw9

View 2xw9 on RCSB PDB site
Description: Crystal Structure of Complement Factor D mutant S183A
Class: hydrolase
Keywords: immune system, hydrolase, serine protease, alternative pathway
Deposited on 2010-11-01, released 2011-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.14528
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement factor d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00746 (0-227)
      • engineered mutation (182)
    Domains in SCOPe 2.08: d2xw9a_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xw9A (A:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdaggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla