PDB entry 2xvz

View 2xvz on RCSB PDB site
Description: cobalt chelatase cbik (periplasmatic) from desulvobrio vulgaris hildenborough (co-crystallized with cobalt)
Class: metal binding protein
Keywords: metal binding protein
Deposited on 2010-10-28, released 2010-12-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.17211
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chelatase, putative
    Species: DESULFOVIBRIO VULGARIS [TaxId:882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2xvza_
  • Heterogens: HEM, CO, SO4, GOL, NA, CL, PER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xvzA (A:)
    ghgapkaqktgillvafgtsveearpaldkmgdrvraahpdipvrwaytakmiraklrae
    giaapspaealagmaeegfthvavqslhtipgeefhglletahafqglpkgltrvsvglp
    ligttadaeavaealvaslpadrkpgepvvfmghgtphpadicypglqyylwrldpdllv
    gtvegspsfdnvmaeldvrkakrvwlmplmavagdharndmagdeddswtsqlarrgiea
    kpvlhgtaesdavaaiwlrhlddalarln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xvzA (A:)
    aqktgillvafgtsveearpaldkmgdrvraahpdipvrwaytakmiraklraegiaaps
    paealagmaeegfthvavqslhtipgeefhglletahafqglpkgltrvsvglpligtta
    daeavaealvaslpadrkpgepvvfmghgtphpadicypglqyylwrldpdllvgtvegs
    psfdnvmaeldvrkakrvwlmplmavagdharndmagdeddswtsqlarrgieakpvlhg
    taesdavaaiwlrhlddalarln