PDB entry 2xvs

View 2xvs on RCSB PDB site
Description: Crystal structure of human TTC5 (Strap) C-terminal OB domain
Deposited on 2010-10-31, released 2010-11-17
The last revision was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1755
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetratricopeptide repeat protein 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N0Z6 (2-165)
      • expression tag (0-1)
  • Heterogens: IOD, EDO, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xvsA (A:)
smrqreqqllefldrltslleskgkvktkklqsmlgslrpahlgpcsdghyqsasgqkvt
lelkplstlqpgvnsgavilgkvvfsltteekvpftfglvdsdgpcyavmvynivqswgv
ligdsvaipepnlrlhriqhkgkdysfssvrvetplllvvngkpqg