PDB entry 2xvc

View 2xvc on RCSB PDB site
Description: molecular and structural basis of escrt-iii recruitment to membranes during archaeal cell division
Deposited on 2010-10-25, released 2011-02-02
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: escrt-III
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZJ6 (9-58)
      • expression tag (3-8)
  • Chain 'B':
    Compound: cdva, sso0911
    Species: SULFOLOBUS SOLFATARICUS, synthetic [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xvcA (A:)
mahhhhhhmiterelldyivnnggfldiehfskvygvekqevvkllealknkgliaves

    Sequence, based on observed residues (ATOM records):
    >2xvcA (A:)
hhhhhmiterelldyivnnggfldiehfskvygvekqevvkllealknkgliaves

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2xvcB (B:)
seiplpipvkvintl

    Sequence, based on observed residues (ATOM records):
    >2xvcB (B:)
iplpipvkvintl