PDB entry 2xv6

View 2xv6 on RCSB PDB site
Description: crystal structure of the hiv-1 capsid protein c-terminal domain (146-220) in complex with a camelid vhh.
Class: viral protein/immune system
Keywords: viral protein-immune system complex
Deposited on 2010-10-22, released 2011-10-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.1759
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2xv6a_
  • Chain 'B':
    Compound: camelid vhh 9
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XV6
    Domains in SCOPe 2.05: d2xv6b_
  • Chain 'C':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2xv6c_
  • Chain 'D':
    Compound: camelid vhh 9
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XV6
    Domains in SCOPe 2.05: d2xv6d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xv6A (A:)
    sptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkal
    gpgatleemmtacqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xv6B (B:)
    maqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmst
    vyddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvsshhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xv6B (B:)
    aqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstv
    yddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xv6C (C:)
    sptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkal
    gpgatleemmtacqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xv6C (C:)
    tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalat
    leemmtac
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xv6D (D:)
    maqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmst
    vyddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvsshhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xv6D (D:)
    qvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstvy
    ddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvss