PDB entry 2xv3

View 2xv3 on RCSB PDB site
Description: Pseudomonas aeruginosa Azurin with mutated metal-binding loop sequence (CAAAAHAAAAM), chemically reduced, pH5.3
Class: electron transport
Keywords: electron transport, cupredoxin fold
Deposited on 2010-10-22, released 2010-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.18717
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-128)
      • engineered mutation (112-115)
      • engineered mutation (117)
      • insertion (118)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d2xv3a_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-128)
      • engineered mutation (112-115)
      • engineered mutation (117)
      • insertion (118)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d2xv3b_
  • Heterogens: CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xv3A (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcaaaahaaa
    amkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xv3B (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcaaaahaaa
    amkgtltlk