PDB entry 2xv0

View 2xv0 on RCSB PDB site
Description: pseudomonas aeruginosa azurin with mutated metal-binding loop sequence (caahaam), chemically reduced, ph4.8
Class: electron transport
Keywords: electron transport, cupredoxin fold
Deposited on 2010-10-22, released 2010-12-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.14919
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Azurin
  Species: Pseudomonas aeruginosa [TaxId:287]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00282 (0-124)
    • insertion (112-116)
  Domains in SCOPe 2.01: d2xv0a_
• Heterogens: CU1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xv0A (A:)
  aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
  tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcaahaamkg
  tltlk