PDB entry 2xv0

View 2xv0 on RCSB PDB site
Description: Pseudomonas aeruginosa Azurin with mutated metal-binding loop sequence (CAAHAAM), chemically reduced, pH4.8
Class: electron transport
Keywords: electron transport, cupredoxin fold
Deposited on 2010-10-22, released 2010-12-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Azurin
  Species: Pseudomonas aeruginosa [TaxId:287]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00282 (0-124)
    • engineered mutation (112-114)
    • engineered mutation (116)
  Domains in SCOPe 2.08: d2xv0a_
• Heterogens: CU1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xv0A (A:)
  aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
  tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcaahaamkg
  tltlk