PDB entry 2xun

View 2xun on RCSB PDB site
Description: structure of pii from synechococcus elongatus in complex with 2-oxoglutarate at low 2-og concentrations
Class: signaling protein
Keywords: signaling protein, glnk
Deposited on 2010-10-19, released 2010-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.17673
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • expression tag (112-114)
    Domains in SCOPe 2.07: d2xuna1, d2xuna2
  • Chain 'B':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • expression tag (112-114)
    Domains in SCOPe 2.07: d2xunb1, d2xunb2
  • Chain 'C':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • expression tag (112)
    Domains in SCOPe 2.07: d2xunc1, d2xunc2
  • Chain 'D':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • expression tag (112-114)
    Domains in SCOPe 2.07: d2xund1, d2xund2
  • Chain 'E':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xune_
  • Chain 'F':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • expression tag (112)
    Domains in SCOPe 2.07: d2xunf1, d2xunf2
  • Chain 'G':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • expression tag (112-114)
    Domains in SCOPe 2.07: d2xung1, d2xung2
  • Chain 'H':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xunh_
  • Chain 'I':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2xuni_
  • Heterogens: ATP, AKG, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xunA (A:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xunA (A:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteytveflqklkleivve
    daqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xunB (B:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xunB (B:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqtereytveflqklkleiv
    vedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2xunC (C:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xunC (C:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadais
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2xunD (D:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xunD (D:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgtveflqklkleivvedaqv
    dtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2xunE (E:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xunE (E:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrveflqklkleivvedaqvdtvi
    dkivaaartgeigdgkifvspvdqtirirtgeknada
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2xunF (F:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xunF (F:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqterytveflqklkleivv
    edaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadais
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2xunG (G:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xunG (G:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteeytveflqklkleivv
    edaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2xunH (H:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xunH (H:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgekna
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2xunI (I:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xunI (I:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryveflqklkleivve
    daqvdtvidkivaaartgeigdgkifvspvdqtirirtgekna