PDB entry 2xum

View 2xum on RCSB PDB site
Description: factor inhibiting hif (fih) q239h mutant in complex with zn(II), nog and asp-substrate peptide (20-mer)
Class: oxidoreductase/peptide
Keywords: oxidoreductase-peptide complex, non-heme, dioxygenase, oxygenase, hypoxia, metal-binding, helix-loop-helix-beta, facial triad signaling, beta-hydroxylation, transcription activator/inhibitor
Deposited on 2010-10-19, released 2010-12-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.20228
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypoxia-inducible factor 1-alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NWT6 (0-348)
      • engineered mutation (238)
    Domains in SCOPe 2.01: d2xuma_
  • Chain 'S':
    Compound: asp-substrate peptide 2
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XUM (Start-19)
  • Heterogens: ZN, OGA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xumA (A:)
maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrhs
qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn

  • Chain 'S':
    No sequence available.