PDB entry 2xug

View 2xug on RCSB PDB site
Description: crystal structure of mache-y337a-tz2pa6 anti complex (1 wk)
Class: hydrolase
Keywords: hydrolase, hydrolase fold, click chemistry
Deposited on 2010-10-19, released 2010-12-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.19247
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21836
      • engineered mutation (336)
    Domains in SCOPe 2.06: d2xuga_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21836 (Start-543)
      • engineered mutation (336)
      • see remark 999 (543)
    Domains in SCOPe 2.06: d2xugb_
  • Heterogens: NAG, P6G, TZ4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xugA (A:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
    pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsaflvygvpgfskdneslisraqfl
    agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
    qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
    tnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
    sata
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xugA (A:)
    redpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvlda
    ttfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyggg
    fysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqw
    vqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsag
    earrratllarlvgcppgndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgd
    flsdtpealintgdfqdlqvlvgvvkdegsaflvygvpgfskdneslisraqflagvrig
    vpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvy
    ayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfart
    gdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpklls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2xugB (B:)
    egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
    dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
    ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
    qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
    agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
    pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsaflvygvpgfskdneslisraqfl
    agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
    qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
    tnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
    sata
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xugB (B:)
    edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
    tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
    ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
    qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
    arrratllarlvgcppndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdfl
    sdtpealintgdfqdlqvlvgvvkdegsaflvygvpgfskdneslisraqflagvrigvp
    qasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyay
    ifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartgd
    pndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsata