PDB entry 2xtu

View 2xtu on RCSB PDB site
Description: Structure of E.coli rhomboid protease GlpG active site mutant, S201T in trigonal crystal form
Class: hydrolase
Keywords: hydrolase, membrane protein
Deposited on 2010-10-12, released 2011-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rhomboid protease glpg
  Species: ESCHERICHIA COLI [TaxId:469008]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09391 (0-180)
    • engineered mutation (110)
  Domains in SCOPe 2.08: d2xtua_
• Heterogens: BNG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2xtuA (A:)
  eragpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmh
  ilfnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfggltgvvyalmgy
  vwlrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdsl
  n