PDB entry 2xtt

View 2xtt on RCSB PDB site
Description: bovine trypsin in complex with evolutionary enhanced schistocerca gregaria protease inhibitor 1 (sgpi-1-p02)
Deposited on 2010-10-12, released 2010-11-10
The last revision was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 0.93 Å
R-factor: N/A
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease inhibitor sgpi-1
    Species: SCHISTOCERCA GREGARIA, synthetic [TaxId:7010]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O46162 (Start-34)
      • see remark 999 (4)
      • see remark 999 (17)
      • see remark 999 (19-21)
      • see remark 999 (29)
      • expression tag (35)
  • Chain 'B':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xttA (A:)
eqecepgqtkkqdcntcrcgsdgvwactrmgcppha

    Sequence, based on observed residues (ATOM records):
    >2xttA (A:)
qecepgqtkkqdcntcrcgsdgvwactrmgcppha

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2xttB (B:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn