PDB entry 2xtj

View 2xtj on RCSB PDB site
Description: the crystal structure of pcsk9 in complex with 1d05 fab
Class: hydrolase/antibody
Keywords: hydrolase-antibody complex, serine protease, ldl-c, ldlr, egf-a, hypercholesterolemia
Deposited on 2010-10-10, released 2010-11-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.20293
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NBP7
      • see remark 999 (264)
    Domains in SCOPe 2.06: d2xtja_
  • Chain 'B':
    Compound: fab from a human monoclonal antibody, 1d05
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XTJ (0-106)
    Domains in SCOPe 2.06: d2xtjb_
  • Chain 'C':
    Compound: fab from a human monoclonal antibody, 1d05
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XTJ (0-End)
  • Chain 'D':
    Compound: fab from a human monoclonal antibody, 1d05
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XTJ (0-130)
    Domains in SCOPe 2.06: d2xtjd_
  • Chain 'E':
    Compound: fab from a human monoclonal antibody, 1d05
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XTJ (0-101)
  • Chain 'P':
    Compound: proprotein convertase subtilisin-kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xtjA (A:)
    sipwnleritppryradeyqppdggslvevylldtsiqsdhreiegrvmvtdfenvpeed
    gtrfhrqaskcdshgthlagvvsgrdagvakgasmrslrvlncqgkgtvsgtliglefir
    ksqlvqpvgplvvllplaggysrvlnaacqrlaragvvlvtaagnfrddaclyspasape
    vitvgatnaqdqpvtlgtlgtnfgrcvdlfapgediigassdcstcfvsqsgtsqaaahv
    agiaammlsaepeltlaelrqrlilfsakdvineawfpedqrvltpnlvaalppsthgaa
    gtaaashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xtjA (A:)
    pwnslvevylldtsiqsdhreiegrvmvtdfenvpeedqaskcdshgthlagvvsgrdag
    vakgasmrslrvlncqgkgtvsgtliglefirksqlvqpvgplvvllplaggysrvlnaa
    cqrlaragvvlvtaagnfrddaclyspasapevitvgatnaqdqpvtlgtlgtnfgrcvd
    lfapgediigassdcstcfvsqsgtsqaaahvagiaammlsaepeltlaelrqrlilfsa
    kd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xtjB (B:)
    diqmtqspsslsasvgdrvtitcrasqgirsalnwyqqkpgkapklliyngstlqsgvps
    rfsgsgsgtdftltisslqpedfavyycqqfdgdptfgqgtkveikr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xtjD (D:)
    qvqlvqsgaevkkpgssvkvsckasggtfnshaiswvrqapgqglewmgginpilgiany
    aqkfqgrvtitadeststaymelsslrsedtavyycarhyeiqigrygmnvyylmyrfas
    wgqgtlvtvss
    

  • Chain 'E':
    No sequence available.

  • Chain 'P':
    No sequence available.