PDB entry 2xt3

View 2xt3 on RCSB PDB site
Description: human kif7, a kinesin involved in hedgehog signalling
Class: motor protein
Keywords: motor protein, signal transduction
Deposited on 2010-10-04, released 2011-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.1816
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kinesin-like protein kif7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2M1P5 (Start-343)
      • engineered mutation (222)
      • engineered mutation (294)
    Domains in SCOPe 2.06: d2xt3a_
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xt3A (A:)
    gamglpgaeeapvrvalrvrpllpkellhghqsclqvepglgrvtlgrdrhfgfhvvlae
    dagqeavyqacvqplleaffegfnatvfaygqtgsgktytmgeasvaslledeqgivpra
    maeafklidendlldclvhvsylevykeefrdllevgtasrdiqlredergnvvlcgvke
    vdvegldevlsllemgnaarhtgathlnhlssrshtvftvtlkqrgrapsrlprpapgql
    lvskfhfvdlagservlktgstgelrkesiqinssllalgnvisalgdpqrrgsnipyrd
    skitrilkdslggnaktvmiacvspsssdfdetlntlnyasraq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xt3A (A:)
    eeapvrvalrvrpllpkellhghqsclqvepglgrvtlgrdrhfgfhvvlaedagqeavy
    qacvqplleaffegfnatvfaygqtgsgktytmgeadeqgivpramaeafklidendlld
    clvhvsylevykeefrdllevgtasrdiqlredergnvvlcgvkevdvegldevlsllem
    gnaarhthlssrshtvftvtlkqrgrapllvskfhfvdlagservlqinssllalgnvis
    algdpqrrgsnipyrdskitrilkdslggnaktvmiacvspsssdfdetlntlnyasraq