PDB entry 2xt1

View 2xt1 on RCSB PDB site
Description: Crystal structure of the HIV-1 capsid protein C-terminal domain (146- 231) in complex with a camelid VHH.
Class: viral protein/immune system
Keywords: viral protein-immune system complex
Deposited on 2010-10-03, released 2011-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71B32 (0-85)
      • conflict (62)
    Domains in SCOPe 2.08: d2xt1a_
  • Chain 'B':
    Compound: camelid vhh 9
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XT1 (Start-114)
    Domains in SCOPe 2.08: d2xt1b1, d2xt1b2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2xt1A (A:)
sptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkal
gpgatleemmtacqgvggpghkarvl

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2xt1B (B:)
maqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmst
vyddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvsshhhhh
h

    Sequence, based on observed residues (ATOM records): (download) 
    >2xt1B (B:)
aqvqlvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstv
yddsvkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvss