PDB entry 2xt0

View 2xt0 on RCSB PDB site
Description: dehalogenase dppa from plesiocystis pacifica sir-I
Class: hydrolase
Keywords: hydrolase, alpha-beta hydrolase fold
Deposited on 2010-10-02, released 2011-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.22081
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haloalkane dehalogenase
    Species: PLESIOCYSTIS PACIFICA [TaxId:191768]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6G7B1 (0-296)
      • cloning artifact (264)
    Domains in SCOPe 2.08: d2xt0a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2xt0A (A:)
    mefvrtpddrfadlpdfpyaphyleglpgfeglrmhyvdegprdaehtflclhgepswsf
    lyrkmlpvftaaggrvvapdlfgfgrsdkptddavytfgfhrrsllafldalqlervtlv
    cqdwggilgltlpvdrpqlvdrlivmntalavglspgkgfeswrdfvanspdldvgklmq
    raipgitdaevaaydapfpgpefkagvrrfpaivpitpdmegaeigrqamsfwstqwsgp
    tfmavgaqdpvlgpevmgmlrqairgcpepmiveagghfvqehgepiaraalaafgq