PDB entry 2xsk

View 2xsk on RCSB PDB site
Description: E. coli curli protein CsgC - SeCys
Deposited on 2010-09-29, released 2010-12-29
The last revision was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.23929
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: csgc
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xskA (A:)
    mgssqitfnttqqgdmytiipevtltqsalarvqilslregssgqsqtkqektlslpanq
    pialtklslnispddrvkivvtvsdgqslhlsqqwppssekslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >2xskA (A:)
    ssqitfnttqqgdmytiipevtltqsalarvqilslregssgqsqtkqektlslpanqpi
    altklslnispddrvkivvtvsdgqslhlsqqwpp