PDB entry 2xsi

View 2xsi on RCSB PDB site
Description: human serum albumin complexed with dansyl-l-glutamate and myristic acid
Class: transport protein
Keywords: transport protein
Deposited on 2010-10-29, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.191
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02768
      • conflict (520)
    Domains in SCOPe 2.07: d2xsia1, d2xsia2, d2xsia3
  • Heterogens: MYR, 9NE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xsiA (A:)
    dahksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesae
    ncdkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpev
    dvmctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllp
    kldelrdegkassakqrlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltk
    vhtecchgdllecaddradlakyicenqdsissklkeccekpllekshciaevendempa
    dlpslaadfveskdvcknyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekc
    caaadphecyakvfdefkplveepqnlikqncelfeqlgeykfqnallvrytkkvpqvst
    ptlvevsrnlgkvgskcckhpeakrmpcaedylsvvlnqlcvlhektpvsdrvtkcctes
    lvnrrpcfsalevdetyvpkefnaetftfhadictlsekeeqikkqtalvelvkhkpkat
    keqlkavmddfaafvekcckaddketcfaeegkklvaasqaalgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xsiA (A:)
    hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
    dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
    mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
    delrdegkassakqrlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvh
    tecchgdllecaddradlakyicenqdsissklkeccekpllekshciaevendempadl
    pslaadfveskdvcknyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekcca
    aadphecyakvfdefkplveepqnlikqncelfeqlgeykfqnallvrytkkvpqvstpt
    lvevsrnlgkvgskcckhpeakrmpcaedylsvvlnqlcvlhektpvsdrvtkccteslv
    nrrpcfsalevdetyvpkefnaetftfhadictlsekeeqikkqtalvelvkhkpkatke
    qlkavmddfaafvekcckaddketcfaeegkklvaasqaalg