PDB entry 2xs7

View 2xs7 on RCSB PDB site
Description: crystal structure of the rrm domain of mouse deleted in azoospermia-like in complex with sycp3 rna, uuguuu
Deposited on 2010-09-24, released 2011-10-05
The last revision was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.16471
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deleted in azoospermia-like
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 5'-r(*up*up*gp*up*up*up)-3'
    Species: Mus musculus, synthetic [TaxId:10090]
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xs7A (A:)
slpegkimpntvfvggidvrmdeteirsffarygsvkevkiitdrtgvskgygfvsfynd
vdvqkivesqinfhgkklklgpairkq

    Sequence, based on observed residues (ATOM records):
    >2xs7A (A:)
lpegkimpntvfvggidvrmdeteirsffarygsvkevkiitdrtgvskgygfvsfyndv
dvqkivesqinfhgkklklgpairkq

  • Chain 'B':
    No sequence available.