PDB entry 2xs6

View 2xs6 on RCSB PDB site
Description: crystal structure of the rhogap domain of human pik3r2
Deposited on 2010-09-24, released 2010-11-17
The last revision was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 3-kinase regulatory subunit beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2xs6A (A:)
    mhhhhhhssgvdlgtenlyfqsmgltlpdlpeqfsppdvappllvklveaiertgldses
    hyrpelpaprtdwslsdvdqwdtaaladgiksfllalpaplvtpeasaearralreaagp
    vgpalepptlplhraltlrfllqhlgrvarrapalgpavralgatfgplllrappppssp
    ppggapdgsepspdfpallvekllqehleeqeva
    

    Sequence, based on observed residues (ATOM records):
    >2xs6A (A:)
    ltlpdlpeqfsppdvappllvklveaiertgldseshyrpelpaprtdwslsdvdqwdta
    aladgiksfllalpaplvtpeasaearralreapvgpalepptlplhraltlrfllqhlg
    rvarrapalgpavralgatfgplllrpspdfpallvekllqehlee