PDB entry 2xs3

View 2xs3 on RCSB PDB site
Description: structure of karilysin catalytic mmp domain
Deposited on 2010-09-24, released 2010-11-03
The last revision was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: karilysin protease
    Species: TANNERELLA FORSYTHIA [TaxId:28112]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: karilysin protease
    Species: TANNERELLA FORSYTHIA [TaxId:28112]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: peptide ala-phe-thr-ser
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XS3 (0-3)
  • Chain 'D':
    Compound: peptide ala-phe-thr-ser
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2XS3 (0-3)
  • Heterogens: ZN, TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2xs3A (A:)
yvlqgskwnkttlkyyiynssshlttterenairsafalwsdkstlsfiqvynpnqadik
ikwekgnhgdgypfdgntgilahafypppaggnyaghlhfdddenwsingsgidlitvaa
heighllgiehsnvssalmypyytgikrqldnddclavwdlygypf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2xs3B (B:)
yvlqgskwnkttlkyyiynssshlttterenairsafalwsdkstlsfiqvynpnqadik
ikwekgnhgdgypfdgntgilahafypppaggnyaghlhfdddenwsingsgidlitvaa
heighllgiehsnvssalmypyytgikrqldnddclavwdlygypf

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >2xs3C (C:)
afts

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >2xs3D (D:)
afts